Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARL4A Peptide - middle region

ARL4A Peptide - middle region

Product Specifications

Product Name Alternative

ARL4

UniProt

P40617

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001032241.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HFWDVGGQEKLRPLWKSYTRCTDGIVFVVDSVDVERMEEAKTELHKITRI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BORA (NM_001286747) Human Tagged ORF Clone
RG238520 10 µg

BORA (NM_001286747) Human Tagged ORF Clone

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS706543 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
(±)-threo-1-Hydroxy Mephedrone Hydrochloride
TRC-H944830-2.5MG 2.5 mg

(±)-threo-1-Hydroxy Mephedrone Hydrochloride

Sign In for Pricing
View Details
Recombinant ZHX2 Antibody
RC-4266-01 50 μL

Recombinant ZHX2 Antibody

Sign In for Pricing
View Details
Recombinant ZHX2 Antibody
RC-4266-02 100 µL

Recombinant ZHX2 Antibody

Sign In for Pricing
View Details
Recombinant ZHX2 Antibody
RC-4266-03 1 mL

Recombinant ZHX2 Antibody

Sign In for Pricing
View Details