Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARL4A Peptide - middle region

ARL4A Peptide - middle region

Product Specifications

Product Name Alternative

ARL4

UniProt

P40617

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001032241.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HFWDVGGQEKLRPLWKSYTRCTDGIVFVVDSVDVERMEEAKTELHKITRI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EBAG9 Mouse Monoclonal Antibody [Clone ID: 22-1-1]
AM26435AF-N 100 µL

EBAG9 Mouse Monoclonal Antibody [Clone ID: 22-1-1]

Sign In for Pricing
View Details
EGFR (Epidermal Growth Factor Receptor) (GFR/2968R), CF488A conjugate, 0.1mg/mL
BNC882968-100 1x 100 µL

EGFR (Epidermal Growth Factor Receptor) (GFR/2968R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ADH1B Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H7]
TA502776AM 100 µL

ADH1B Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H7]

Sign In for Pricing
View Details
Troponin I fast skeletal muscle (TNNI2) (N-term) Goat Polyclonal Antibody
AP32708PU-N 100 µg

Troponin I fast skeletal muscle (TNNI2) (N-term) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Trim55 Mouse Gene Knockout Kit (CRISPR)
KN518224 1 Kit

Trim55 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS649297 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details