Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TYW1 Peptide - middle region

TYW1 Peptide - middle region

Product Specifications

Product Name Alternative

TYW1A, RSAFD1, YPL207W

UniProt

Q9NV66

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060734.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ETTPSLACANKCVFCWRHHTNPVGTEWRWKMDQPEMILKEAIENHQNMIK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human ITGA10 pAb
PA10410-01 50 μL

Rabbit Anti-Human ITGA10 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human ITGA10 pAb
PA10410-02 100 μL

Rabbit Anti-Human ITGA10 pAb

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Kidney Injury Molecule 1 (Kim1)
MBS2047419-01 0.1 mL

HRP-Linked Polyclonal Antibody to Kidney Injury Molecule 1 (Kim1)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Kidney Injury Molecule 1 (Kim1)
MBS2047419-02 0.2 mL

HRP-Linked Polyclonal Antibody to Kidney Injury Molecule 1 (Kim1)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Kidney Injury Molecule 1 (Kim1)
MBS2047419-03 0.5 mL

HRP-Linked Polyclonal Antibody to Kidney Injury Molecule 1 (Kim1)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Kidney Injury Molecule 1 (Kim1)
MBS2047419-04 1 mL

HRP-Linked Polyclonal Antibody to Kidney Injury Molecule 1 (Kim1)

Sign In for Pricing
View Details