Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCAS2 Peptide - C-terminal region

BCAS2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DAM1, SPF27, Snt309

UniProt

O75934

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005863.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human REA (PHB2) activation kit by CRISPRa
GA107798 1 Kit

Human REA (PHB2) activation kit by CRISPRa

Sign In for Pricing
View Details
Fluo-3, AM *UltraPure grade* *CAS 121714-22-5*
21011-AAT 1 mg

Fluo-3, AM *UltraPure grade* *CAS 121714-22-5*

Sign In for Pricing
View Details
Undecylbenzene
TRC-U789005-5ML 5 mL

Undecylbenzene

Sign In for Pricing
View Details
SLAP2 (SLA2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D8]
TA505078AM 100 µL

SLAP2 (SLA2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D8]

Sign In for Pricing
View Details
Recombinant AREB6 Monoclonal Antibody
AN301025L-01 50 µL

Recombinant AREB6 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant AREB6 Monoclonal Antibody
AN301025L-02 100 µL

Recombinant AREB6 Monoclonal Antibody

Sign In for Pricing
View Details