Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCAS2 Peptide - C-terminal region

BCAS2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DAM1, SPF27, Snt309

UniProt

O75934

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005863.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3,5-Lutidine
TRC-L478040-5G 5 g

3,5-Lutidine

Sign In for Pricing
View Details
Pyy Mouse Gene Knockout Kit (CRISPR)
KN514298 1 Kit

Pyy Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Aquaporin 0 (MIP) Human Gene Knockout Kit (CRISPR)
KN416810 1 Kit

Aquaporin 0 (MIP) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NODAL (NM_018055) Human Over-expression Lysate
LC402640 20 µg

NODAL (NM_018055) Human Over-expression Lysate

Sign In for Pricing
View Details
MYADM Human qPCR Primer Pair (NM_138373)
HP229481 200 Reactions

MYADM Human qPCR Primer Pair (NM_138373)

Sign In for Pricing
View Details
Phospho-AKT2 (S474) Rabbit Polyclonal Antibody
HA500116 100 µL

Phospho-AKT2 (S474) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details