Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABHD11 Peptide - middle region

ABHD11 Peptide - middle region

Product Specifications

Product Name Alternative

PP1226, WBSCR21

UniProt

Q8NFV4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001138836.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PAVVFLHGLFGSKTNFNSIAKILAQQTGRRVLTVDARNHGDSPHSPDMSY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4930550L24Rik Mouse shRNA Plasmid (Locus ID 75352)
TR519227 1 Kit

4930550L24Rik Mouse shRNA Plasmid (Locus ID 75352)

Sign In for Pricing
View Details
Anti-PDE4B antibody
STJ70005 100 µg

Anti-PDE4B antibody

Sign In for Pricing
View Details
Mouse PECAM-1/CD31 ELISA Kit
BEK1027 96 Tests

Mouse PECAM-1/CD31 ELISA Kit

Sign In for Pricing
View Details
DECR2 Adenovirus (Rat)
17872056 1.0 mL

DECR2 Adenovirus (Rat)

Sign In for Pricing
View Details
Horse Carbamoyl-Phosphate Synthetase 1, Mitochondrial (CPS1) ELISA Kit
MBS9919483-01 48 Well

Horse Carbamoyl-Phosphate Synthetase 1, Mitochondrial (CPS1) ELISA Kit

Sign In for Pricing
View Details
Horse Carbamoyl-Phosphate Synthetase 1, Mitochondrial (CPS1) ELISA Kit
MBS9919483-02 96 Well

Horse Carbamoyl-Phosphate Synthetase 1, Mitochondrial (CPS1) ELISA Kit

Sign In for Pricing
View Details