What is the catalog number for ABHD11 Peptide - middle region?

The catalog number for ABHD11 Peptide - middle region is orb1999411.

What sizes are available for ABHD11 Peptide - middle region?

ABHD11 Peptide - middle region is available in the following size(s): 100 µg.

Is ABHD11 Peptide - middle region in stock?

ABHD11 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

ABHD11 Peptide - middle region

Product Specifications

Product Name Alternative

PP1226, WBSCR21

UniProt

Q8NFV4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001138836.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PAVVFLHGLFGSKTNFNSIAKILAQQTGRRVLTVDARNHGDSPHSPDMSY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OPPA01952-5UG 5 µg

Frataxin Protein

Sign In for Pricing

View Details

MBS7151202 Inquire

Rabbit anti-Oryza sativa subsp. indica (Rice) 20ox2 Polyclonal Antibody

Sign In for Pricing

View Details

MBS1202468 Inquire

Recombinant Saccharomyces cerevisiae EH domain-containing and endocytosis protein 1 (EDE1) , partial

Sign In for Pricing

View Details

FAB110CL1 0.1 mL

Mouse Monoclonal IgG Antibody (97924) [CoraFluor 1]

Sign In for Pricing

View Details

MBS9011867 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) At1g23390 Polyclonal Antibody

Sign In for Pricing

View Details

E45R12499N-100 100 µL

NDRG1 Rabbit mAb

Sign In for Pricing

View Details