Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HARS2 Peptide - middle region

HARS2 Peptide - middle region

Product Specifications

Product Name Alternative

HO3, HARSL, HARSR, PRLTS2

UniProt

P49590

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001265660.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ELKETLTEKYGEDSGLMYDLKDQGGELLSLRYDLTVPFARYLAMNKVKKM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Mrps12 shRNA (UAS) - Lentiviral mouse Mrps12 shRNA (UAS) plasmid
GTR15295822 1 Vial

Lentiviral mouse Mrps12 shRNA (UAS) - Lentiviral mouse Mrps12 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Gelsolin (GSN, Actin Depolymerizing Factor, ADF, AGEL, Amyloidosis Finnish Type, Brevin, DKFZp313L0718) (FITC)
MBS6477682-01 0.1 mL

Gelsolin (GSN, Actin Depolymerizing Factor, ADF, AGEL, Amyloidosis Finnish Type, Brevin, DKFZp313L0718) (FITC)

Sign In for Pricing
View Details
Gelsolin (GSN, Actin Depolymerizing Factor, ADF, AGEL, Amyloidosis Finnish Type, Brevin, DKFZp313L0718) (FITC)
MBS6477682-02 5x 0.1 mL

Gelsolin (GSN, Actin Depolymerizing Factor, ADF, AGEL, Amyloidosis Finnish Type, Brevin, DKFZp313L0718) (FITC)

Sign In for Pricing
View Details
Human Soluble Neural cell adhesion molecule 1 (sNCAM1/ CD56) ELISA Kit
CK-bio-25723-01 48 Tests

Human Soluble Neural cell adhesion molecule 1 (sNCAM1/ CD56) ELISA Kit

Sign In for Pricing
View Details
Human Soluble Neural cell adhesion molecule 1 (sNCAM1/ CD56) ELISA Kit
CK-bio-25723-02 96 Tests

Human Soluble Neural cell adhesion molecule 1 (sNCAM1/ CD56) ELISA Kit

Sign In for Pricing
View Details
TSPAN6 Antibody
MBS9524049-01 0.04 mL

TSPAN6 Antibody

Sign In for Pricing
View Details