Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DECR1 Peptide - middle region

DECR1 Peptide - middle region

Product Specifications

Product Name Alternative

DECR, NADPH, SDR18C1

UniProt

Q16698

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001350.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GVEAMSKSLAAEWGKYGMRFNVIQPGPIKTKGAFSRLDPTGTFEKEMIGR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPIN4 Antibody
MBS7004640-01 0.05 mg

SPIN4 Antibody

Sign In for Pricing
View Details
SPIN4 Antibody
MBS7004640-02 0.1 mg

SPIN4 Antibody

Sign In for Pricing
View Details
SPIN4 Antibody
MBS7004640-03 5x 0.1 mg

SPIN4 Antibody

Sign In for Pricing
View Details
BLCAP Adenovirus (Mouse)
13338054 1.0 mL

BLCAP Adenovirus (Mouse)

Sign In for Pricing
View Details
ALDH7A1 Antibody
A12416-100UG 100 µg

ALDH7A1 Antibody

Sign In for Pricing
View Details
IL8/CXCL8 Mouse Monoclonal Antibody
orb2960424-01 100 µg

IL8/CXCL8 Mouse Monoclonal Antibody

Sign In for Pricing
View Details