Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DECR1 Peptide - middle region

DECR1 Peptide - middle region

Product Specifications

Product Name Alternative

DECR, NADPH, SDR18C1

UniProt

Q16698

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001350.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GVEAMSKSLAAEWGKYGMRFNVIQPGPIKTKGAFSRLDPTGTFEKEMIGR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Inhibitor mmu-miR-6358 AAV miRNA Vector
Amm3125000 500 ng

Inhibitor mmu-miR-6358 AAV miRNA Vector

Sign In for Pricing
View Details
Recombinant Outer membrane protein P5 (ompA)
MBS1170695-01 0.02 mg (E-Coli)

Recombinant Outer membrane protein P5 (ompA)

Sign In for Pricing
View Details
Recombinant Outer membrane protein P5 (ompA)
MBS1170695-02 0.1 mg (E-Coli)

Recombinant Outer membrane protein P5 (ompA)

Sign In for Pricing
View Details
Recombinant Outer membrane protein P5 (ompA)
MBS1170695-03 1 mg (E-Coli)

Recombinant Outer membrane protein P5 (ompA)

Sign In for Pricing
View Details
Recombinant Outer membrane protein P5 (ompA)
MBS1170695-04 5x 1 mg (E-Coli)

Recombinant Outer membrane protein P5 (ompA)

Sign In for Pricing
View Details
Recombinant Emericella nidulans Probable beta-glucosidase F (bglF), partial
MBS1464475 Inquire

Recombinant Emericella nidulans Probable beta-glucosidase F (bglF), partial

Sign In for Pricing
View Details