What is the catalog number for PRPF4 Peptide - middle region?

The catalog number for PRPF4 Peptide - middle region is orb1999406.

What sizes are available for PRPF4 Peptide - middle region?

PRPF4 Peptide - middle region is available in the following size(s): 100 µg.

Is PRPF4 Peptide - middle region in stock?

PRPF4 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

PRPF4 Peptide - middle region

Product Specifications

Product Name Alternative

PRP4, RP70, HPRP4, Prp4p, HPRP4P, SNRNP60

UniProt

O43172

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001231855.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DDEKSKKSKEEYQQTWYHEGPNSLKVARLWIANYSLPRAMKRLEEARLHK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP1-49529AF647 0.1 mL

Mouse Monoclonal ApoE4 Antibody (4E4) [Alexa Fluor 647]

Sign In for Pricing

View Details

267643-01 1 g

3-Chloropyridine-4-boronic acid pinacol ester

Sign In for Pricing

View Details

267643-02 2 g

3-Chloropyridine-4-boronic acid pinacol ester

Sign In for Pricing

View Details

267643-03 5 g

3-Chloropyridine-4-boronic acid pinacol ester

Sign In for Pricing

View Details

RK03187 96 Tests

Mouse Sestrin-3 (SESN3) ELISA Kit

Sign In for Pricing

View Details

CN-03271H1 96T

Human Vascuolar cell adhesion molecule 1,VCAM-1 ELISA kit

Sign In for Pricing

View Details