Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRPF4 Peptide - middle region

PRPF4 Peptide - middle region

Product Specifications

Product Name Alternative

PRP4, RP70, HPRP4, Prp4p, HPRP4P, SNRNP60

UniProt

O43172

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001231855.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DDEKSKKSKEEYQQTWYHEGPNSLKVARLWIANYSLPRAMKRLEEARLHK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sulphuric Acid Solution 3.0M (6.0N)
VM5282-E 1 L

Sulphuric Acid Solution 3.0M (6.0N)

Sign In for Pricing
View Details
AQP6 siRNA (Mouse)
MBS8238292-01 15 nmol

AQP6 siRNA (Mouse)

Sign In for Pricing
View Details
AQP6 siRNA (Mouse)
MBS8238292-02 30 nmol

AQP6 siRNA (Mouse)

Sign In for Pricing
View Details
AQP6 siRNA (Mouse)
MBS8238292-03 5x 30 nmol

AQP6 siRNA (Mouse)

Sign In for Pricing
View Details
Human RAD51AP1 Recombinant Protein
PPT-14911 100 µg

Human RAD51AP1 Recombinant Protein

Sign In for Pricing
View Details
Lentiviral human ZMAT5 shRNA (UAS) - Lentiviral human ZMAT5 shRNA (UAS) (100)
GTR15163470 1 Vial

Lentiviral human ZMAT5 shRNA (UAS) - Lentiviral human ZMAT5 shRNA (UAS) (100)

Sign In for Pricing
View Details