Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FASTK Peptide - N-terminal region

FASTK Peptide - N-terminal region

Product Specifications

Product Name Alternative

FAST

UniProt

Q14296

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001245390.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SGLLLIPPVQPCCLGPSKWGDRPVGGGPSAGPVQGLQRLLEQAKSPGELL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASAH1 Human Gene Knockout Kit (CRISPR)
KN202135 1 Kit

ASAH1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ssna1 (NM_023464) Mouse Tagged ORF Clone
MG200558 10 µg

Ssna1 (NM_023464) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human Lambda Light Chain (HP6054), CF640R conjugate, 0.1mg/mL
BNC400262-500 1x 500 µL

Human Lambda Light Chain (HP6054), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human GW182 (TNRC6A) activation kit by CRISPRa
GA109121 1 Kit

Human GW182 (TNRC6A) activation kit by CRISPRa

Sign In for Pricing
View Details
Apolipoprotein L 1 (APOL1) Mouse Monoclonal Antibody [Clone ID: 1D4]
AM06309SU-N 100 µL

Apolipoprotein L 1 (APOL1) Mouse Monoclonal Antibody [Clone ID: 1D4]

Sign In for Pricing
View Details
Recombinant Human HSPB11 Protein (His Tag)
PKSH032522-01 10 µg

Recombinant Human HSPB11 Protein (His Tag)

Sign In for Pricing
View Details