Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FASTK Peptide - N-terminal region

FASTK Peptide - N-terminal region

Product Specifications

Product Name Alternative

FAST

UniProt

Q14296

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001245390.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SGLLLIPPVQPCCLGPSKWGDRPVGGGPSAGPVQGLQRLLEQAKSPGELL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPREB3 antibody
FNab09425 100 µg

VPREB3 antibody

Sign In for Pricing
View Details
REV1 (NM_016316) Human Over-expression Lysate
LY402538 100 µg

REV1 (NM_016316) Human Over-expression Lysate

Sign In for Pricing
View Details
IL 6 Mouse, Sf9
OM296522-01 10 µg

IL 6 Mouse, Sf9

Sign In for Pricing
View Details
IL 6 Mouse, Sf9
OM296522-02 2 µg

IL 6 Mouse, Sf9

Sign In for Pricing
View Details
IL 6 Mouse, Sf9
OM296522-03 1 mg

IL 6 Mouse, Sf9

Sign In for Pricing
View Details
DBNDD1 (NM_001042610) Human Over-expression Lysate
LC421006 20 µg

DBNDD1 (NM_001042610) Human Over-expression Lysate

Sign In for Pricing
View Details