Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCT6A Peptide - middle region

CCT6A Peptide - middle region

Product Specifications

Product Name Alternative

CCT6, Cctz, HTR3, TCPZ, TCP20, MoDP-2, TTCP20, CCT-zeta, CCT-zeta-1, TCP-1-zeta

UniProt

Q92526

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001009186.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KKQDEPIDLFMIEIMEMKHKSETDTSLIRGLVLDHGARHPDMKKRVEDAY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ANKRD12 shRNA (UAS) - Lentiviral human ANKRD12 shRNA (UAS) (25)
GTR15314144 1 Vial

Lentiviral human ANKRD12 shRNA (UAS) - Lentiviral human ANKRD12 shRNA (UAS) (25)

Sign In for Pricing
View Details
CORO2B, NT (CORO2B, KIAA0925, Coronin-2B, Coronin-like protein C, Protein FC96) (MaxLight 750)
MBS6288019-01 0.1 mL

CORO2B, NT (CORO2B, KIAA0925, Coronin-2B, Coronin-like protein C, Protein FC96) (MaxLight 750)

Sign In for Pricing
View Details
CORO2B, NT (CORO2B, KIAA0925, Coronin-2B, Coronin-like protein C, Protein FC96) (MaxLight 750)
MBS6288019-02 5x 0.1 mL

CORO2B, NT (CORO2B, KIAA0925, Coronin-2B, Coronin-like protein C, Protein FC96) (MaxLight 750)

Sign In for Pricing
View Details
Lentiviral human COG3 shRNA (UAS) - Lentiviral human COG3 shRNA (UAS) (25)
GTR15348404 1 Vial

Lentiviral human COG3 shRNA (UAS) - Lentiviral human COG3 shRNA (UAS) (25)

Sign In for Pricing
View Details
Methyl 4-[ (1,1-Dimethylethoxy) carbonyl]benzeneundecynoate
OR1002852-01 10 mg

Methyl 4-[ (1,1-Dimethylethoxy) carbonyl]benzeneundecynoate

Sign In for Pricing
View Details
Methyl 4-[ (1,1-Dimethylethoxy) carbonyl]benzeneundecynoate
OR1002852-02 50 mg

Methyl 4-[ (1,1-Dimethylethoxy) carbonyl]benzeneundecynoate

Sign In for Pricing
View Details