CCT6A Peptide - middle region
CCT6A Peptide - middle region
Product Specifications
Product Name Alternative
CCT6, Cctz, HTR3, TCPZ, TCP20, MoDP-2, TTCP20, CCT-zeta, CCT-zeta-1, TCP-1-zeta
UniProt
Q92526
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001009186.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KKQDEPIDLFMIEIMEMKHKSETDTSLIRGLVLDHGARHPDMKKRVEDAY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6265409-01 0.1 mL
Carcinoembryonic Antigen (CEA, Carcinoembryonic Antigen-related Cell Adhesion Molecule 5, CEACAM5, CD66e, CD66e Antigen, Meconium Antigen 100) (MaxLight 750)
Sign In for Pricing
View Details MBS6265409-02 5x 0.1 mL
Carcinoembryonic Antigen (CEA, Carcinoembryonic Antigen-related Cell Adhesion Molecule 5, CEACAM5, CD66e, CD66e Antigen, Meconium Antigen 100) (MaxLight 750)
Sign In for Pricing
View Details 