Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TOR1AIP1 Peptide - C-terminal region

TOR1AIP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

LAP1, LAP1B

UniProt

Q5JTV8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001254507.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TLGTSLGLKEVEEKVRDFLKVKFTNSNTPNSYNHMDPDKLNGLWSRISHL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fatty Acid Desaturase 1
546758 200 µL

Fatty Acid Desaturase 1

Sign In for Pricing
View Details
GREB1 Polyclonal Antibody
RD76860A-01 20 µL

GREB1 Polyclonal Antibody

Sign In for Pricing
View Details
GREB1 Polyclonal Antibody
RD76860A-02 60 μL

GREB1 Polyclonal Antibody

Sign In for Pricing
View Details
GREB1 Polyclonal Antibody
RD76860A-03 120 μL

GREB1 Polyclonal Antibody

Sign In for Pricing
View Details
GREB1 Polyclonal Antibody
RD76860A-04 200 µL

GREB1 Polyclonal Antibody

Sign In for Pricing
View Details
GRID1 Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-12095R-PerCP-Cy5.5 100 µL

GRID1 Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details