Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TOR1AIP1 Peptide - C-terminal region

TOR1AIP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

LAP1, LAP1B

UniProt

Q5JTV8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001254507.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TLGTSLGLKEVEEKVRDFLKVKFTNSNTPNSYNHMDPDKLNGLWSRISHL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H-b-Chloro-Ala-NHOH
F-3380.0250 250.0mg

H-b-Chloro-Ala-NHOH

Sign In for Pricing
View Details
MIB1 Recombinant Antibody, Cy5 Conjugated
bsm-61914R-Cy5-TR 20 µL

MIB1 Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Alpha-2-Heremans Schmid Glycoprotein (AHSG), Recombinant, Guinea Pig, His-Tag
054040-01 10 µg

Alpha-2-Heremans Schmid Glycoprotein (AHSG), Recombinant, Guinea Pig, His-Tag

Sign In for Pricing
View Details
Alpha-2-Heremans Schmid Glycoprotein (AHSG), Recombinant, Guinea Pig, His-Tag
054040-02 50 µg

Alpha-2-Heremans Schmid Glycoprotein (AHSG), Recombinant, Guinea Pig, His-Tag

Sign In for Pricing
View Details
Alpha-2-Heremans Schmid Glycoprotein (AHSG), Recombinant, Guinea Pig, His-Tag
054040-03 100 µg

Alpha-2-Heremans Schmid Glycoprotein (AHSG), Recombinant, Guinea Pig, His-Tag

Sign In for Pricing
View Details
Alpha-2-Heremans Schmid Glycoprotein (AHSG), Recombinant, Guinea Pig, His-Tag
054040-04 200 µg

Alpha-2-Heremans Schmid Glycoprotein (AHSG), Recombinant, Guinea Pig, His-Tag

Sign In for Pricing
View Details