Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPEF1 Peptide - middle region

PPEF1 Peptide - middle region

Product Specifications

Product Name Alternative

PP7, PPEF, PPP7C, PPP7CA

UniProt

O14829

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_006231.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CHDGKVVTIFSASNYYEEGSNRGAYIKLCSGTTPRFFQYQVTKATCFQPL

More Discoveries

Explore Other Products

Browse additional items from our catalog

OCT6 (H-6) Alexa Fluor® 790
sc-390056 AF790 200 µg/mL

OCT6 (H-6) Alexa Fluor® 790

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Carotene epsilon-monooxygenase, chloroplastic (CYP97C1) , partial
MBS1429105 Inquire

Recombinant Arabidopsis thaliana Carotene epsilon-monooxygenase, chloroplastic (CYP97C1) , partial

Sign In for Pricing
View Details
Human PTGER2 VersaClone cDNA
RDC0174 10 µg

Human PTGER2 VersaClone cDNA

Sign In for Pricing
View Details
POLDIP2 (Polymerase Delta-interacting Protein 2, p38, POLD4, PDIP38) (MaxLight 650)
MBS6432136-01 0.1 mL

POLDIP2 (Polymerase Delta-interacting Protein 2, p38, POLD4, PDIP38) (MaxLight 650)

Sign In for Pricing
View Details
POLDIP2 (Polymerase Delta-interacting Protein 2, p38, POLD4, PDIP38) (MaxLight 650)
MBS6432136-02 5x 0.1 mL

POLDIP2 (Polymerase Delta-interacting Protein 2, p38, POLD4, PDIP38) (MaxLight 650)

Sign In for Pricing
View Details
Krtap19-2 Mouse shRNA Plasmid (Locus ID 170651)
TL506055 1 Kit

Krtap19-2 Mouse shRNA Plasmid (Locus ID 170651)

Sign In for Pricing
View Details