Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPEF1 Peptide - middle region

PPEF1 Peptide - middle region

Product Specifications

Product Name Alternative

PP7, PPEF, PPP7C, PPP7CA

UniProt

O14829

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_006231.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CHDGKVVTIFSASNYYEEGSNRGAYIKLCSGTTPRFFQYQVTKATCFQPL

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human AREG pAb
PA12038-01 50 μL

Rabbit Anti-Human AREG pAb

Sign In for Pricing
View Details
Rabbit Anti-Human AREG pAb
PA12038-02 100 μL

Rabbit Anti-Human AREG pAb

Sign In for Pricing
View Details
LRRC63, CT (LRRC63, Leucine-rich repeat-containing protein 63) (MaxLight 550) discontinued
037969-ML550 100 µL

LRRC63, CT (LRRC63, Leucine-rich repeat-containing protein 63) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Canine Fibulin ELISA kit
GTR10374842 96 Well

Canine Fibulin ELISA kit

Sign In for Pricing
View Details
KDELC1 (KDEL Motif-Containing Protein 1)
484087 100 µL

KDELC1 (KDEL Motif-Containing Protein 1)

Sign In for Pricing
View Details
Low Sample Volume ELISA Kit for Pepsin (PP)
TRV-0037621-01 24 Tests

Low Sample Volume ELISA Kit for Pepsin (PP)

Sign In for Pricing
View Details