Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PEF1 Peptide - middle region

PEF1 Peptide - middle region

Product Specifications

Product Name Alternative

ABP32, PEF1A

UniProt

Q9UBV8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_036524.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QGGAPPNVDPEAYSWFQSVDSDHSGYISMKELKQALVNCNWSSFNDETCL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF149 Mouse Monoclonal Antibody [Clone ID: OTI4G8]
CF810424 100 µg

RNF149 Mouse Monoclonal Antibody [Clone ID: OTI4G8]

Sign In for Pricing
View Details
TPMT Recombinant Rabbit Monoclonal Antibody [JE64-09]
HA721049 100 µL

TPMT Recombinant Rabbit Monoclonal Antibody [JE64-09]

Sign In for Pricing
View Details
Muc1 Rabbit Polyclonal Antibody
ER1902-10 100 µL

Muc1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PICALM Recombinant Rabbit monoclonal Antibody
HA750740 100 µL

PICALM Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
NQO1 (NM_001025434) Human Over-expression Lysate
LC425499 20 µg

NQO1 (NM_001025434) Human Over-expression Lysate

Sign In for Pricing
View Details
E-Click EdU Cell Proliferation Imaging Assay Kit (Green, Elab Fluor® 488)
E-CK-A376-01 50 Assays

E-Click EdU Cell Proliferation Imaging Assay Kit (Green, Elab Fluor® 488)

Sign In for Pricing
View Details