Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PEF1 Peptide - middle region

PEF1 Peptide - middle region

Product Specifications

Product Name Alternative

ABP32, PEF1A

UniProt

Q9UBV8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_036524.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QGGAPPNVDPEAYSWFQSVDSDHSGYISMKELKQALVNCNWSSFNDETCL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAX1 (NM_006192) Human Over-expression Lysate
LC401864 20 µg

PAX1 (NM_006192) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human LILRB5/CD85c protein (His tag)
PDMH100136-01 20 µg

Recombinant Human LILRB5/CD85c protein (His tag)

Sign In for Pricing
View Details
Recombinant Human LILRB5/CD85c protein (His tag)
PDMH100136-02 100 µg

Recombinant Human LILRB5/CD85c protein (His tag)

Sign In for Pricing
View Details
Recombinant Human LILRB5/CD85c protein (His tag)
PDMH100136-03 500 µg

Recombinant Human LILRB5/CD85c protein (His tag)

Sign In for Pricing
View Details
Recombinant Human LILRB5/CD85c protein (His tag)
PDMH100136-04 1 mg

Recombinant Human LILRB5/CD85c protein (His tag)

Sign In for Pricing
View Details
C14orf93 (NM_001282968) Human Tagged ORF Clone
RG237707 10 µg

C14orf93 (NM_001282968) Human Tagged ORF Clone

Sign In for Pricing
View Details