CNOT9 Peptide - middle region
CNOT9 Peptide - middle region
Product Specifications
Product Name Alternative
RCD1, CAF40, CT129, RCD-1, RQCD1
UniProt
Q92600
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001258563.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLTAHQSNRVCN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TL508906V 500 µL Each
Ifi214 Mouse shRNA Lentiviral Particle (Locus ID 545384)
Sign In for Pricing
View Details orb3090123 100 µg
Zebrafish SF3B4 Rabbit Polyclonal Antibody (Fluoro594)
Sign In for Pricing
View Details MBS720349-01 48 Well
Rat cysteinyl aspartate specific proteinases 9 ELISA Kit
Sign In for Pricing
View Details