CNOT9 Peptide - middle region
CNOT9 Peptide - middle region
Product Specifications
Product Name Alternative
RCD1, CAF40, CT129, RCD-1, RQCD1
UniProt
Q92600
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001258563.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLTAHQSNRVCN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
32-10078-500 500 µg
Recombinant Human EH domain-containing protein 2/EHD2
Sign In for Pricing
View Details 
CAU22456-01 100 µL
Lysyl Oxidase Like Protein 2 (LOXL2) Polyclonal Antibody
Sign In for Pricing
View Details CAU22456-02 200 µL
Lysyl Oxidase Like Protein 2 (LOXL2) Polyclonal Antibody
Sign In for Pricing
View Details CAU22456-03 1 mL
Lysyl Oxidase Like Protein 2 (LOXL2) Polyclonal Antibody
Sign In for Pricing
View Details 
