ALG5 Peptide - middle region
ALG5 Peptide - middle region
Product Specifications
Product Name Alternative
BA421P11.2
UniProt
Q9Y673
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001135836.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NAKGQKETLPSIWDSPTKQLSVVVPSYNEEKRLPVMMDEALSYLEKRQKR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
16829114 3x 1.0 µg
Crhr2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
Sign In for Pricing
View Details 
abx335506-01 20 µg
Ring Finger Protein 19A, RBR E3 Ubiquitin Protein Ligase (RNF19A) Antibody (FITC)
Sign In for Pricing
View Details abx335506-02 50 µg
Ring Finger Protein 19A, RBR E3 Ubiquitin Protein Ligase (RNF19A) Antibody (FITC)
Sign In for Pricing
View Details