Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALG5 Peptide - middle region

ALG5 Peptide - middle region

Product Specifications

Product Name Alternative

BA421P11.2

UniProt

Q9Y673

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001135836.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NAKGQKETLPSIWDSPTKQLSVVVPSYNEEKRLPVMMDEALSYLEKRQKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNX27 Rabbit Polyclonal Antibody (Biotin)
orb2985296 100 µg

SNX27 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
HOXB4 (NM_024015) Human Untagged Clone
SC125778 10 µg

HOXB4 (NM_024015) Human Untagged Clone

Sign In for Pricing
View Details
Recombinant Rhesus Macaque ICOS Protein, His (Fc)-Avi-tagged
ICOS-2008R 50 µg

Recombinant Rhesus Macaque ICOS Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Recombinant Human SERPINB5 Protein, N-His
AP91527 50 µg

Recombinant Human SERPINB5 Protein, N-His

Sign In for Pricing
View Details
CASP3 Antibody (C-term) Blocking peptide
MBS9218314-01 0.5 mg

CASP3 Antibody (C-term) Blocking peptide

Sign In for Pricing
View Details
CASP3 Antibody (C-term) Blocking peptide
MBS9218314-02 5x 0.5 mg

CASP3 Antibody (C-term) Blocking peptide

Sign In for Pricing
View Details