Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPA14 Peptide - C-terminal region

HSPA14 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HSP70-4, HSP70L1

UniProt

Q0VDF9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_057383.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSVCLELYESDGKNSAKEETKFAQVVLQDLDKKENGLRDILAVLTMKRDG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse SDR16C6 Protein, His (Fc)-Avi-tagged
SDR16C6-7974M 50 µg

Recombinant Mouse SDR16C6 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Cyclobutanecarboxylic acid chloride
FC43718-01 100 g

Cyclobutanecarboxylic acid chloride

Sign In for Pricing
View Details
Cyclobutanecarboxylic acid chloride
FC43718-02 250 g

Cyclobutanecarboxylic acid chloride

Sign In for Pricing
View Details
Cyclobutanecarboxylic acid chloride
FC43718-03 500 g

Cyclobutanecarboxylic acid chloride

Sign In for Pricing
View Details
MLk4 (Center) (Mouse) Rabbit pAb
E2612612 100 µL

MLk4 (Center) (Mouse) Rabbit pAb

Sign In for Pricing
View Details
CCDC23 AAV siRNA Pooled Vector
15244161 1.0 µg

CCDC23 AAV siRNA Pooled Vector

Sign In for Pricing
View Details