Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPA14 Peptide - C-terminal region

HSPA14 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HSP70-4, HSP70L1

UniProt

Q0VDF9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_057383.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSVCLELYESDGKNSAKEETKFAQVVLQDLDKKENGLRDILAVLTMKRDG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E2F8 (Transcription Factor E2F8, E2F-8, FLJ23311) APC
MBS6136344-01 0.1 mL

E2F8 (Transcription Factor E2F8, E2F-8, FLJ23311) APC

Sign In for Pricing
View Details
E2F8 (Transcription Factor E2F8, E2F-8, FLJ23311) APC
MBS6136344-02 5x 0.1 mL

E2F8 (Transcription Factor E2F8, E2F-8, FLJ23311) APC

Sign In for Pricing
View Details
UVSSA Rabbit Polyclonal Antibody
orb3070766-01 30 µL

UVSSA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
UVSSA Rabbit Polyclonal Antibody
orb3070766-02 50 µL

UVSSA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
UVSSA Rabbit Polyclonal Antibody
orb3070766-03 100 µL

UVSSA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
UVSSA Rabbit Polyclonal Antibody
orb3070766-04 200 µL

UVSSA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details