Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NRBF2 Peptide - middle region

NRBF2 Peptide - middle region

Product Specifications

Product Name Alternative

COPR, COPR1, COPR2, NRBF-2

UniProt

Q96F24

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001269334.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EFLVAENERLRKENKQLKAEKARLLKGPIEKELDVDADFVETSELWSLPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Soluble Cluster of Differentiation 86 ELISA Kit
MBS009158-01 48 Well

Porcine Soluble Cluster of Differentiation 86 ELISA Kit

Sign In for Pricing
View Details
Porcine Soluble Cluster of Differentiation 86 ELISA Kit
MBS009158-02 96 Well

Porcine Soluble Cluster of Differentiation 86 ELISA Kit

Sign In for Pricing
View Details
Porcine Soluble Cluster of Differentiation 86 ELISA Kit
MBS009158-03 5x 96 Well

Porcine Soluble Cluster of Differentiation 86 ELISA Kit

Sign In for Pricing
View Details
Porcine Soluble Cluster of Differentiation 86 ELISA Kit
MBS009158-04 10x 96 Well

Porcine Soluble Cluster of Differentiation 86 ELISA Kit

Sign In for Pricing
View Details
Human Lactoferrin ELISA Kit
CEK2468 96 Tests

Human Lactoferrin ELISA Kit

Sign In for Pricing
View Details
ORP8 Rabbit pAb, PE-Cy5 conjugated
orb2855167 100 µL

ORP8 Rabbit pAb, PE-Cy5 conjugated

Sign In for Pricing
View Details