Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTBD1 Peptide - C-terminal region

BTBD1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C15orf1, NS5ATP8

UniProt

Q9H0C5

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001011885.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TLKGPDSHYGTKGLKKVVHETPAASKTVFFFFSSPGNNNGTSIEDGQIPE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDCL Rabbit Polyclonal Antibody
TA366476 100 µL

PDCL Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TRAPPC2B (NR_002166) Human Recombinant Protein
TP315934M 100 µg

TRAPPC2B (NR_002166) Human Recombinant Protein

Sign In for Pricing
View Details
Amaranth (>85%)
TRC-A575988-5G 5 g

Amaranth (>85%)

Sign In for Pricing
View Details
IMPA1 (NM_001144878) Human Recombinant Protein
TP720208 10 µg

IMPA1 (NM_001144878) Human Recombinant Protein

Sign In for Pricing
View Details
Colupulone
TRC-C214755-50MG 50 mg

Colupulone

Sign In for Pricing
View Details
6-Thioinosine Phosphate (~90%)
TRC-T344500-25MG 25 mg

6-Thioinosine Phosphate (~90%)

Sign In for Pricing
View Details