Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTBD1 Peptide - C-terminal region

BTBD1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C15orf1, NS5ATP8

UniProt

Q9H0C5

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001011885.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TLKGPDSHYGTKGLKKVVHETPAASKTVFFFFSSPGNNNGTSIEDGQIPE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EMA (MUC1) Rabbit Monoclonal Antibody [Clone ID: PAM4]
TA386533 200 µg

EMA (MUC1) Rabbit Monoclonal Antibody [Clone ID: PAM4]

Sign In for Pricing
View Details
HOPX (C-term) Rabbit Polyclonal Antibody
AP52072PU-N 400 µL

HOPX (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse Esm1 protein (His tag)
PDEM100270-01 20 µg

Recombinant Mouse Esm1 protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse Esm1 protein (His tag)
PDEM100270-02 100 µg

Recombinant Mouse Esm1 protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse Esm1 protein (His tag)
PDEM100270-03 500 µg

Recombinant Mouse Esm1 protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse Esm1 protein (His tag)
PDEM100270-04 1 mg

Recombinant Mouse Esm1 protein (His tag)

Sign In for Pricing
View Details