Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NEK11 Peptide - middle region

NEK11 Peptide - middle region

Product Specifications

UniProt

Q8NG66

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001139475.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LTGTPHYMSPEALKHQGYDTKSDIWSLACILYEMCCMNHAFAGSNFLSIV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Breast
CS804844 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
Recombinant Human MEK2/MAP2K2/MKK2 Protein (GST Tag)
PKSH031494 50 µg

Recombinant Human MEK2/MAP2K2/MKK2 Protein (GST Tag)

Sign In for Pricing
View Details
KIF21A Human Gene Knockout Kit (CRISPR)
KN417610 1 Kit

KIF21A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ZNF384 (NM_001039920) Human Over-expression Lysate
LC421856 20 µg

ZNF384 (NM_001039920) Human Over-expression Lysate

Sign In for Pricing
View Details
Jtb (NM_206924) Mouse Tagged ORF Clone
MG200972 10 µg

Jtb (NM_206924) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Trap1 Antibody: PerCP
SMC-207D-PCP 100 µg

Trap1 Antibody: PerCP

Sign In for Pricing
View Details