Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NEK11 Peptide - middle region

NEK11 Peptide - middle region

Product Specifications

UniProt

Q8NG66

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001139475.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LTGTPHYMSPEALKHQGYDTKSDIWSLACILYEMCCMNHAFAGSNFLSIV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAT6 Human Gene Knockout Kit (CRISPR)
KN210065LP 1 Kit

STAT6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
P14ARF (4C6/4), CF488A conjugate, 0.1mg/mL
BNC882088-100 1x 100 µL

P14ARF (4C6/4), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytoplasmic dynein 1 light intermediate chain 1 (DYNC1LI1) Human Gene Knockout Kit (CRISPR)
KN422010 1 Kit

Cytoplasmic dynein 1 light intermediate chain 1 (DYNC1LI1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Colloidal Gold Conjugated Morniga G Lectin (black mulberry) -MNA-G-,  5nm
GP-9005-5 1 mL

Colloidal Gold Conjugated Morniga G Lectin (black mulberry) -MNA-G-, 5nm

Sign In for Pricing
View Details
SH3 containing Grb 2 like 1 protein (SH3GL1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3F8]
TA501539AM 100 µL

SH3 containing Grb 2 like 1 protein (SH3GL1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3F8]

Sign In for Pricing
View Details
Small EDRK rich factor 1 (SERF1A) (NM_022968) Human Recombinant Protein
TP324986M 100 µg

Small EDRK rich factor 1 (SERF1A) (NM_022968) Human Recombinant Protein

Sign In for Pricing
View Details