ARHGAP19 Peptide - middle region
ARHGAP19 Peptide - middle region
Product Specifications
UniProt
Q14CB8
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001191229.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HFNAHLKIADLMQFDDKGNKTNIPDKDRQIEALQLLFLILPPPNRNLLKL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BIB1407 1 Each
5-Bromo-3-indolyl beta-D-glucuronide cyclohexylammonium salt
Sign In for Pricing
View Details 
MBS1353486-01 0.5 mg (E-Coli)
Recombinant Shewanella denitrificans Cell division protein ZipA homolog (zipA), partial
Sign In for Pricing
View Details MBS1353486-02 0.05 mg (Baculovirus)
Recombinant Shewanella denitrificans Cell division protein ZipA homolog (zipA), partial
Sign In for Pricing
View Details MBS1353486-03 0.5 mg (Yeast)
Recombinant Shewanella denitrificans Cell division protein ZipA homolog (zipA), partial
Sign In for Pricing
View Details MBS1353486-04 0.05 mg (Mammalian-Cell)
Recombinant Shewanella denitrificans Cell division protein ZipA homolog (zipA), partial
Sign In for Pricing
View Details MBS1353486-05 1 mg (E-Coli)
Recombinant Shewanella denitrificans Cell division protein ZipA homolog (zipA), partial
Sign In for Pricing
View Details