Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARHGAP19 Peptide - middle region

ARHGAP19 Peptide - middle region

Product Specifications

UniProt

Q14CB8

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001191229.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HFNAHLKIADLMQFDDKGNKTNIPDKDRQIEALQLLFLILPPPNRNLLKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magic™ Membrane Protein Human SERPINB13 (Serpin family B member 13) for Antibody Discovery
MP0757J Each

Magic™ Membrane Protein Human SERPINB13 (Serpin family B member 13) for Antibody Discovery

Sign In for Pricing
View Details
Recombinant Neisseria Gonorrhoeae dapA Protein (aa 1-291)
VAng-Wyb2496-50gEcoli 50 µg (E. coli)

Recombinant Neisseria Gonorrhoeae dapA Protein (aa 1-291)

Sign In for Pricing
View Details
Human ZDHHC1 siRNA
abx940336-01 15 nmol

Human ZDHHC1 siRNA

Sign In for Pricing
View Details
Human ZDHHC1 siRNA
abx940336-02 30 nmol

Human ZDHHC1 siRNA

Sign In for Pricing
View Details
Recombinant Human IL-4 (Mammalian)
PHH0929-01 10 µg

Recombinant Human IL-4 (Mammalian)

Sign In for Pricing
View Details
Recombinant Human IL-4 (Mammalian)
PHH0929-02 50 µg

Recombinant Human IL-4 (Mammalian)

Sign In for Pricing
View Details