What is the catalog number for ARHGAP19 Peptide - middle region?

The catalog number for ARHGAP19 Peptide - middle region is orb1999377.

What sizes are available for ARHGAP19 Peptide - middle region?

ARHGAP19 Peptide - middle region is available in the following size(s): 100 µg.

Is ARHGAP19 Peptide - middle region in stock?

ARHGAP19 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

ARHGAP19 Peptide - middle region

Product Specifications

UniProt

Q14CB8

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001191229.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HFNAHLKIADLMQFDDKGNKTNIPDKDRQIEALQLLFLILPPPNRNLLKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP1-30176CL1 0.1 mL

Mouse Monoclonal ORF73/HHV8 Antibody (4C11) [CoraFluor 1]

Sign In for Pricing

View Details

MBS6353637-01 0.2 mL

TAS1R2, CT (TAS1R2, GPR71, T1R2, TR2, Taste receptor type 1 member 2, G-protein coupled receptor 71, Sweet taste receptor T1R2) (Azide free) (HRP)

Sign In for Pricing

View Details

MBS6353637-02 5x 0.2 mL

TAS1R2, CT (TAS1R2, GPR71, T1R2, TR2, Taste receptor type 1 member 2, G-protein coupled receptor 71, Sweet taste receptor T1R2) (Azide free) (HRP)

Sign In for Pricing

View Details

NBP1-80594PEP 0.1 mL

ZNF323 Recombinant Protein Antigen

Sign In for Pricing

View Details

K1856903 1.0 µg DNA

RNU7-24P sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing

View Details

245439-ML490 100 µL

DNAJB6 (DnaJ (Hsp40) Homolog, Subfamily B, Member 6, DJ4, DKFZp566D0824, DnaJ, FLJ42837, HHDJ1, HSJ-2, HSJ2, MGC1152, MGC117297, MRJ, MSJ-1) (MaxLight 490)

Sign In for Pricing

View Details