Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CPNE3 Peptide - middle region

CPNE3 Peptide - middle region

Product Specifications

Product Name Alternative

CPN3, PRO1071

UniProt

O75131

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_003900.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DGSHDLIGTFQTTMTKLKEASRSSPVEFECINEKKRQKKKSYKNSGVISV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cefuracetime (E-isomer) Sodium Salt
TRC-C243940-10MG 10 mg

Cefuracetime (E-isomer) Sodium Salt

Sign In for Pricing
View Details
Gria2 Mouse Monoclonal Antibody [Clone ID: L21/32]
75-002 100 µL

Gria2 Mouse Monoclonal Antibody [Clone ID: L21/32]

Sign In for Pricing
View Details
Myristic Acid
TRC-M884610-5G 5 g

Myristic Acid

Sign In for Pricing
View Details
KIF3A (NM_001300791) Human Tagged ORF Clone
RG239425 10 µg

KIF3A (NM_001300791) Human Tagged ORF Clone

Sign In for Pricing
View Details
HLAB (HLA-B) Rabbit Polyclonal Antibody
TA368265 100 µL

HLAB (HLA-B) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
OTUD4 Rabbit Polyclonal Antibody
TA379529 100 µL

OTUD4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details