Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CPNE3 Peptide - middle region

CPNE3 Peptide - middle region

Product Specifications

Product Name Alternative

CPN3, PRO1071

UniProt

O75131

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_003900.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DGSHDLIGTFQTTMTKLKEASRSSPVEFECINEKKRQKKKSYKNSGVISV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytochrome P450 3A1 / CYP3A1 (P6), CF640R conjugate, 0.1mg/mL
BNC403058-500 1x 500 µL

Cytochrome P450 3A1 / CYP3A1 (P6), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TMPRSS2 Mouse Monoclonal Antibody [Clone ID: OTI4H7]
CF816079 100 µL

TMPRSS2 Mouse Monoclonal Antibody [Clone ID: OTI4H7]

Sign In for Pricing
View Details
PINK1 Human Gene Knockout Kit (CRISPR)
KN206970RB 1 Kit

PINK1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Mouse FABP4/A-FABP Protein (HEK293, His Tag)
PKSM040561 100 µg

Recombinant Mouse FABP4/A-FABP Protein (HEK293, His Tag)

Sign In for Pricing
View Details
Human ARH3 (ADPRHL2) activation kit by CRISPRa
GA110385 1 Kit

Human ARH3 (ADPRHL2) activation kit by CRISPRa

Sign In for Pricing
View Details
GST3 Recombinant Rabbit Monoclonal Antibody [JB40-79]
ET7107-71 100 µL

GST3 Recombinant Rabbit Monoclonal Antibody [JB40-79]

Sign In for Pricing
View Details