Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKN Peptide - middle region

PRKN Peptide - middle region

Product Specifications

Product Name Alternative

PDJ, AR-JP, LPRS2, PARK2

UniProt

O60260

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004553.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCRN2 Polyclonal Antibody
E-AB-52745-01 20 µL

SCRN2 Polyclonal Antibody

Sign In for Pricing
View Details
SCRN2 Polyclonal Antibody
E-AB-52745-02 60 µL

SCRN2 Polyclonal Antibody

Sign In for Pricing
View Details
SCRN2 Polyclonal Antibody
E-AB-52745-03 120 µL

SCRN2 Polyclonal Antibody

Sign In for Pricing
View Details
SCRN2 Polyclonal Antibody
E-AB-52745-04 200 µL

SCRN2 Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Protein Lysate, Stomach
CP621846 150 µg

Tissue Protein Lysate, Stomach

Sign In for Pricing
View Details
Mouse FETUB Antibody Pair Set
E-KAB-0715 50 µL & 100 µg

Mouse FETUB Antibody Pair Set

Sign In for Pricing
View Details