Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKN Peptide - middle region

PRKN Peptide - middle region

Product Specifications

Product Name Alternative

PDJ, AR-JP, LPRS2, PARK2

UniProt

O60260

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004553.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GKELRNDWTVQNCDLDQQSIVHIVQRPWRKGQEMNATGGDDPRNAAGGCE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,5-Anhydroglucitol ELISA Kit
ECP7778-1 96 Tests

1,5-Anhydroglucitol ELISA Kit

Sign In for Pricing
View Details
Recombinant Mycoplasma Hyopneumoniae rplR Protein (aa 1-121) (strain J / ATCC 25934 / NCTC 10110)
VAng-Lsx06564-500gEcoli 500 µg (E. coli)

Recombinant Mycoplasma Hyopneumoniae rplR Protein (aa 1-121) (strain J / ATCC 25934 / NCTC 10110)

Sign In for Pricing
View Details
Prnd sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3457306 1.0 µg DNA

Prnd sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
pLV3×FLAG-CopGFP-Puro Plasmid
PVT54593 2 µg

pLV3×FLAG-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 1 (LRIT1) Antibody
abx349177-01 20 µL

Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 1 (LRIT1) Antibody

Sign In for Pricing
View Details
Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 1 (LRIT1) Antibody
abx349177-02 50 µL

Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 1 (LRIT1) Antibody

Sign In for Pricing
View Details