Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NRP1 Peptide - middle region

NRP1 Peptide - middle region

Product Specifications

Product Name Alternative

NP1, NRP, BDCA4, CD304, VEGF165R

UniProt

O14786

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001019799.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IGYSNNGSDWKMIMDDSKRKAKSFEGNNNYDTPELRTFPALSTRFIRIYP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Smad Interacting Protein 1 (ZEB2) Rabbit Polyclonal Antibody
AP01369PU-N 100 µg

Smad Interacting Protein 1 (ZEB2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MALT1 Mouse Monoclonal Antibody [Clone ID: SPM578]
AM50100PU-T 20 µg

MALT1 Mouse Monoclonal Antibody [Clone ID: SPM578]

Sign In for Pricing
View Details
Tissue Total RNA, Ovary: left
CR560165 5 µg

Tissue Total RNA, Ovary: left

Sign In for Pricing
View Details
MIR1245 Human qPCR Primer Pair (MI0006380)
HP300065 200 Reactions

MIR1245 Human qPCR Primer Pair (MI0006380)

Sign In for Pricing
View Details
4-Dodecylphenol (Mixture Of Isomers)
TRC-D078105-5G 5 g

4-Dodecylphenol (Mixture Of Isomers)

Sign In for Pricing
View Details
N-Acetyl-D-Glucosamine 3,6-Diacetate
TRC-A178220-10MG 10 mg

N-Acetyl-D-Glucosamine 3,6-Diacetate

Sign In for Pricing
View Details