Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NRP1 Peptide - middle region

NRP1 Peptide - middle region

Product Specifications

Product Name Alternative

NP1, NRP, BDCA4, CD304, VEGF165R

UniProt

O14786

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001019799.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IGYSNNGSDWKMIMDDSKRKAKSFEGNNNYDTPELRTFPALSTRFIRIYP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calnexin (Endoplasmic Reticulum Marker) (CANX/1541), CF740 conjugate, 0.1mg/mL
BNC741541-500 1x 500 µL

Calnexin (Endoplasmic Reticulum Marker) (CANX/1541), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
USP16 Mouse Monoclonal Antibody [Clone ID: OTI1H8]
CF809358 100 µg

USP16 Mouse Monoclonal Antibody [Clone ID: OTI1H8]

Sign In for Pricing
View Details
FITC Anti-Mouse CD8a Antibody[53-6.7]
E-AB-F1104C-01 50 Tests

FITC Anti-Mouse CD8a Antibody[53-6.7]

Sign In for Pricing
View Details
FITC Anti-Mouse CD8a Antibody[53-6.7]
E-AB-F1104C-02 100 Tests

FITC Anti-Mouse CD8a Antibody[53-6.7]

Sign In for Pricing
View Details
FITC Anti-Mouse CD8a Antibody[53-6.7]
E-AB-F1104C-03 2x 100 Tests

FITC Anti-Mouse CD8a Antibody[53-6.7]

Sign In for Pricing
View Details
Bronopol
TRC-B809903-50G 50 g

Bronopol

Sign In for Pricing
View Details