Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIF23 Peptide - middle region

KIF23 Peptide - middle region

Product Specifications

Product Name Alternative

CHO1, KNSL5, MKLP1, MKLP-1

UniProt

Q02241

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004847.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LTPGRRYRNQPRGPVGNEPLVTDVVLQSFPPLPSCEILDINDEQTLPRLI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NMT1 (1-496, His-tag) Human Protein
AR51752PU-N 500 µg

NMT1 (1-496, His-tag) Human Protein

Sign In for Pricing
View Details
Canine Orexin (OX) ELISA Kit
BSKD65850-01 48 Tests

Canine Orexin (OX) ELISA Kit

Sign In for Pricing
View Details
Canine Orexin (OX) ELISA Kit
BSKD65850-02 96 Tests

Canine Orexin (OX) ELISA Kit

Sign In for Pricing
View Details
CLU Antibody (N-term)
E45G02671G-1 100 µL

CLU Antibody (N-term)

Sign In for Pricing
View Details
Recombinant Shewanella sp. UPF0391 membrane protein Shewmr4_2671 (Shewmr4_2671), partial
MBS7073524 Inquire

Recombinant Shewanella sp. UPF0391 membrane protein Shewmr4_2671 (Shewmr4_2671), partial

Sign In for Pricing
View Details
DSC2 Knockout A2780 Polyclonal Cells
ARG39795 1 Million

DSC2 Knockout A2780 Polyclonal Cells

Sign In for Pricing
View Details