Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIF23 Peptide - middle region

KIF23 Peptide - middle region

Product Specifications

Product Name Alternative

CHO1, KNSL5, MKLP1, MKLP-1

UniProt

Q02241

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004847.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LTPGRRYRNQPRGPVGNEPLVTDVVLQSFPPLPSCEILDINDEQTLPRLI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Carbonic Anhydrase IX Allophycocyanin MAb (Cl 303123)
FAB2188A 100 Tests

Human Carbonic Anhydrase IX Allophycocyanin MAb (Cl 303123)

Sign In for Pricing
View Details
Syphilis/HIV1.2 Combo Rapid Test device
D-TPHIVCWBD25 25 Tests

Syphilis/HIV1.2 Combo Rapid Test device

Sign In for Pricing
View Details
Tubulin α Antibody
E033531 100 µg -100 µL

Tubulin α Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal SEL1L3 Antibody [Alexa Fluor 647]
NBP2-97792AF647 0.1 mL

Rabbit Polyclonal SEL1L3 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
AP2S1 Polyclonal Antibody
A70782-100 100 µL

AP2S1 Polyclonal Antibody

Sign In for Pricing
View Details
Mouse IgG1 Isotype Control Antibody (HyHEL-10), APC
MV080137-01 1 Each

Mouse IgG1 Isotype Control Antibody (HyHEL-10), APC

Sign In for Pricing
View Details