Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COL2A1 Peptide - C-terminal region

COL2A1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AOM, ANFH, SEDC, STL1, COL11A3

UniProt

P02458

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001835.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CTLDAMKVFCNMETGETCVYPNPANVPKKNWWSSKSKEKKHIWFGETING

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JAK1, CT (Tyrosine-protein kinase JAK1, Janus kinase 1, JAK-1, JAK1A) (MaxLight 550)
MBS6311484-01 0.1 mL

JAK1, CT (Tyrosine-protein kinase JAK1, Janus kinase 1, JAK-1, JAK1A) (MaxLight 550)

Sign In for Pricing
View Details
JAK1, CT (Tyrosine-protein kinase JAK1, Janus kinase 1, JAK-1, JAK1A) (MaxLight 550)
MBS6311484-02 5x 0.1 mL

JAK1, CT (Tyrosine-protein kinase JAK1, Janus kinase 1, JAK-1, JAK1A) (MaxLight 550)

Sign In for Pricing
View Details
CP110 Rabbit Polyclonal Antibody (BF750)
orb2377587 100 µL

CP110 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
SCN10A Protein Vector (Mouse) (pPM-C-HA)
PV227020 500 ng

SCN10A Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
4- (3’,6’-Dimethyl-3’-heptyl) phenol Monoethoxylate
010453 100 mg

4- (3’,6’-Dimethyl-3’-heptyl) phenol Monoethoxylate

Sign In for Pricing
View Details
ELISA Kit for Phosphoenolpyruvate Carboxykinase 1, Soluble (PCK1)
TRV-0041858-01 24 Tests

ELISA Kit for Phosphoenolpyruvate Carboxykinase 1, Soluble (PCK1)

Sign In for Pricing
View Details