What is the catalog number for COL2A1 Peptide - C-terminal region?

The catalog number for COL2A1 Peptide - C-terminal region is orb1999369.

What sizes are available for COL2A1 Peptide - C-terminal region?

COL2A1 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is COL2A1 Peptide - C-terminal region in stock?

COL2A1 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

COL2A1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AOM, ANFH, SEDC, STL1, COL11A3

UniProt

P02458

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001835.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CTLDAMKVFCNMETGETCVYPNPANVPKKNWWSSKSKEKKHIWFGETING

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TR305070 1 Kit

DDX24 Human shRNA Plasmid Kit (Locus ID 57062)

Sign In for Pricing

View Details

MBS9348596 Inquire

Goat Arrestin Beta (ARRB) ELISA Kit

Sign In for Pricing

View Details

BT-411 1 mg

Bovine Uterus Total Protein

Sign In for Pricing

View Details

E28PE4353 100 µL

AMY2B (18V14) Mouse Monoclonal antibody

Sign In for Pricing

View Details

45081051 1.0 mL

SNX3P1Y Adenovirus (Human)

Sign In for Pricing

View Details

VD3N546 1 Each

Rabbit Anti-Mouse CCAAT/Enhancer Binding Protein Gamma (CEBPg) Polyclonal Antibody

Sign In for Pricing

View Details