Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBAC1 Peptide - middle region

UBAC1 Peptide - middle region

Product Specifications

Product Name Alternative

GBDR1, UBADC1

UniProt

Q9BSL1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_057256.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LEENIQDQDVLLLIKKRAPSPLPKMADVSAEEKKKQDQKAPDKEAILRAT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARF5 Recombinant Rabbit Monoclonal Antibody [JE53-83]
ET7110-46 100 µL

ARF5 Recombinant Rabbit Monoclonal Antibody [JE53-83]

Sign In for Pricing
View Details
Recombinant TAK1 Antibody
RC-15651-01 50 μL

Recombinant TAK1 Antibody

Sign In for Pricing
View Details
Recombinant TAK1 Antibody
RC-15651-02 100 µL

Recombinant TAK1 Antibody

Sign In for Pricing
View Details
Recombinant TAK1 Antibody
RC-15651-03 1 mL

Recombinant TAK1 Antibody

Sign In for Pricing
View Details
Prealbumin Rabbit Polyclonal Antibody
0809-10 100 µL

Prealbumin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Electric 3 function medical bed BHBD-414
BHBD-414 1 Unit

Electric 3 function medical bed BHBD-414

Sign In for Pricing
View Details