Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBAC1 Peptide - middle region

UBAC1 Peptide - middle region

Product Specifications

Product Name Alternative

GBDR1, UBADC1

UniProt

Q9BSL1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_057256.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LEENIQDQDVLLLIKKRAPSPLPKMADVSAEEKKKQDQKAPDKEAILRAT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM110A (NM_001289147) Human Tagged ORF Clone
RG237256 10 µg

FAM110A (NM_001289147) Human Tagged ORF Clone

Sign In for Pricing
View Details
GSK3 beta (GSK3B) Mouse Monoclonal Antibody [Clone ID: 1F7]
AM09012PU-N 100 µL

GSK3 beta (GSK3B) Mouse Monoclonal Antibody [Clone ID: 1F7]

Sign In for Pricing
View Details
IGF1 (NM_001111284) Human Over-expression Lysate
LY426359 100 µg

IGF1 (NM_001111284) Human Over-expression Lysate

Sign In for Pricing
View Details
ITIH4 (NM_002218) Human Over-expression Lysate
LY400806 100 µg

ITIH4 (NM_002218) Human Over-expression Lysate

Sign In for Pricing
View Details
CD73 (Immuno-Oncology Target) (NT5E/2646), 0.2mg/mL
BNUB2646-100 1x 100 µL

CD73 (Immuno-Oncology Target) (NT5E/2646), 0.2mg/mL

Sign In for Pricing
View Details
Sombrevin
TRC-S676765-1G 1 g

Sombrevin

Sign In for Pricing
View Details