Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF692 Peptide - middle region

ZNF692 Peptide - middle region

Product Specifications

Product Name Alternative

AREBP, Zfp692

UniProt

Q9BU19

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001129508.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RLPRRVGPPPETFPPPGEEEGEEEEDNDEDEEEMLSDASLWTYSSSPDDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Annexin A9 (G-4) : m-IgG1 BP-HRP Bundle
sc-545405 1 Kit

Annexin A9 (G-4) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
Reticulon 4 Receptor (RTN4R) Antibody
abx008053-01 30 µL

Reticulon 4 Receptor (RTN4R) Antibody

Sign In for Pricing
View Details
Reticulon 4 Receptor (RTN4R) Antibody
abx008053-02 100 µL

Reticulon 4 Receptor (RTN4R) Antibody

Sign In for Pricing
View Details
Reticulon 4 Receptor (RTN4R) Antibody
abx008053-03 200 µL

Reticulon 4 Receptor (RTN4R) Antibody

Sign In for Pricing
View Details
PAX-8 discontinued
474369-01 100 µL

PAX-8 discontinued

Sign In for Pricing
View Details
PAX-8 discontinued
474369-02 1 mL

PAX-8 discontinued

Sign In for Pricing
View Details