ZNF692 Peptide - middle region
ZNF692 Peptide - middle region
Product Specifications
Product Name Alternative
AREBP, Zfp692
UniProt
Q9BU19
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001129508.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RLPRRVGPPPETFPPPGEEEGEEEEDNDEDEEEMLSDASLWTYSSSPDDS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
486833 100 µL
NFIC (Nuclear Factor I/C (CCAAT-Binding Transcription Factor), Nuclear Factor 1 RuleBase RU000690)
Sign In for Pricing
View Details 
MBS9009113 Inquire
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) SESA5 Polyclonal Antibody
Sign In for Pricing
View Details ARP73333_P050 100 µL
LRSAM1 Antibody - N-terminal region (ARP73333_P050)
Sign In for Pricing
View Details MBS9349599-01 48 Well
Sheep Immunoglobulin Superfamily Member 3 (IGSF3) ELISA Kit
Sign In for Pricing
View Details