Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLIP3 Peptide - middle region

CLIP3 Peptide - middle region

Product Specifications

Product Name Alternative

RSNL1, CLIPR59, CLIPR-59

UniProt

Q96DZ5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001186499.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KAVDAPPSSVTSTPRTPRMDFSRVTGKGRREHKGKKKTPSSPSLGSLQQR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Ovary
CR562051 5 µg

Tissue Total RNA, Ovary

Sign In for Pricing
View Details
4,6-Dibromo Olivetol
TRC-B999563-1G 1 g

4,6-Dibromo Olivetol

Sign In for Pricing
View Details
GRK2 (Ab-685) Antibody
8B8278-AAT 50 µg

GRK2 (Ab-685) Antibody

Sign In for Pricing
View Details
H4C7 (NM_003547) Human Recombinant Protein
TP761885 50 µg

H4C7 (NM_003547) Human Recombinant Protein

Sign In for Pricing
View Details
Frozen Tissue Blocks, Neural tissue
CB507015 1 Block

Frozen Tissue Blocks, Neural tissue

Sign In for Pricing
View Details
Recombinant Rhesus macaque CD47/IAP Protein (Fc Tag)
PKSQ050076-01 10 µg

Recombinant Rhesus macaque CD47/IAP Protein (Fc Tag)

Sign In for Pricing
View Details